4.67 Rating by ClearWebStats
247bestpillpharma.com is 1 year 4 months 3 days old. It has a .com as an domain extension. This domain is estimated value of $ 8.95 and has a daily earning of $ 0.15. While no active threats were reported recently by users, 247bestpillpharma.com is SAFE to browse.
Get Custom Widget

Traffic Report of 247bestpillpharma

Daily Unique Visitors: Not Applicable
Daily Pageviews: Not Applicable

Estimated Valuation

Income Per Day: $ 0.15
Estimated Worth: $ 8.95

Search Engine Indexes

Google Indexed Pages: Not Applicable
Yahoo Indexed Pages: Not Applicable
Bing Indexed Pages: Not Applicable

Search Engine Backlinks

Google Backlinks: Not Applicable
Bing Backlinks: Not Applicable
Alexa BackLinks: Not Applicable

Safety Information

Google Safe Browsing: No Risk Issues
Siteadvisor Rating: Not Applicable
WOT Trustworthiness: Not Applicable
WOT Privacy: Not Applicable
WOT Child Safety: Not Applicable

Website Ranks & Scores

Google Pagerank: Not Applicable
Alexa Rank: Not Applicable
Domain Authority: Not Applicable
Google Pagerank
PR 0 out of 10
PageSpeed Score
0
Siteadvisor Rating
View 247bestpillpharma.com site advisor rating Not Applicable

Where is 247bestpillpharma.com server located?

Hosted IP Address:

162.241.148.33 View other site hosted with 247bestpillpharma.com

Hosted Country:

247bestpillpharma.com hosted country US 247bestpillpharma.com hosted country

Location Latitude:

40.2342

Location Longitude:

-111.6442

Social Engagement

Facebook Shares: Not Applicable
Facebook Likes: Not Applicable
Facebook Comments: Not Applicable
Twitter Count (Tweets): Not Applicable
Linkedin Shares: Not Applicable
Delicious Shares: Not Applicable

Page Resources Breakdown

View 247bestpillpharma.com HTML resources

Homepage Links Analysis

247 Best Pill Pharma – Order Prescription Drugs in our Online shop

Website Inpage Analysis

H1 Headings: 1 H2 Headings: 1
H3 Headings: 10 H4 Headings: 1
H5 Headings: Not Applicable H6 Headings: Not Applicable
Total IFRAMEs: Not Applicable Total Images: 86
Google Adsense: Not Applicable Google Analytics: Not Applicable

Websites Hosted on Same IP (i.e. 162.241.148.33)

Home - Jennifer Chem Sales

247bestpillpharma.com favicon - jenniferchemsales.com

View 247bestpillpharma.com Pagerank   247bestpillpharma.com alexa rank Not Applicable   247bestpillpharma.com website value $ 8.95

Shri Vishwakarma Safety Training Institute – Safety & Skill Development Institute

247bestpillpharma.com favicon - shrivishwakarmasafetytraininginstitute.com

View 247bestpillpharma.com Pagerank   247bestpillpharma.com alexa rank Not Applicable   247bestpillpharma.com website value $ 8.95

The Shine English Academy – DREAM | LEARN | SPEAK

247bestpillpharma.com favicon - theshineenglishacademy.com

View 247bestpillpharma.com Pagerank   247bestpillpharma.com alexa rank Not Applicable   247bestpillpharma.com website value $ 8.95

Urvashi International Packers and Movers|Movers and Packers Hyderabad

247bestpillpharma.com favicon - urvashiinternationalpackers.com

Packers and Movers in Hyderabad - Get best price quotes from Packers and Movers in Hyderabad, Movers and Packers in Hyderabad, Packers & Movers in Hyderabad also Get Quote by Hyderabad Packers and Movers from Hyderabad Packers and Movers

View 247bestpillpharma.com Pagerank   247bestpillpharma.com alexa rank Not Applicable   247bestpillpharma.com website value $ 8.95

US Pharmacy Front

247bestpillpharma.com favicon - uspharmacyfront.com

View 247bestpillpharma.com Pagerank   247bestpillpharma.com alexa rank Not Applicable   247bestpillpharma.com website value $ 8.95

HTTP Header Analysis

HTTP/2 200
link: <https://www.247bestpillpharma.com/wp-json/>; rel="https://api.w.org/", <https://www.247bestpillpharma.com/wp-json/wp/v2/pages/28>; rel="alternate"; type="application/json", <https://www.247bestpillpharma.com/>; rel=shortlink
vary: Accept-Encoding
content-encoding: gzip
content-type: text/html; charset=UTF-8
date: Sat, 21 Jan 2023 12:17:52 GMT
server: Apache

Domain Information for 247bestpillpharma.com

Domain Registrar: OwnRegistrar, Inc. 247bestpillpharma.com registrar info
Registration Date: 2023-01-11 1 year 4 months 3 days ago
Last Modified: 2023-01-11 1 year 4 months 3 days ago

Domain Nameserver Information

Host IP Address Country
ns1.bh-ht-17.webhostbox.net 247bestpillpharma.com name server information 162.241.148.33 247bestpillpharma.com server is located in United States United States
ns2.bh-ht-17.webhostbox.net 247bestpillpharma.com name server information 162.241.148.33 247bestpillpharma.com server is located in United States United States

DNS Record Analysis

Host Type TTL Extra
247bestpillpharma.com A 14400 IP:162.241.148.33
247bestpillpharma.com NS 21600 Target:ns2.bh-ht-17.webhostbox.net
247bestpillpharma.com NS 21600 Target:ns1.bh-ht-17.webhostbox.net
247bestpillpharma.com SOA 21600 MNAME:ns1.bh-ht-17.webhostbox.net
RNAME:root.bh-ht-17.webhostbox.net
Serial:2023011204
Refresh:86400
Retry:7200
Expire:3600000
247bestpillpharma.com MX 14400 Target:mail.247bestpillpharma.com
247bestpillpharma.com TXT 14400 TXT:v=spf1 a mx include:websitewelcome.com
~all

Similarly Ranked Websites to 247bestpillpharma

Google

247bestpillpharma.com favicon - google.com

Search the world's information, including webpages, images, videos and more. Google has many special features to help you find exactly what you're looking for.

View 247bestpillpharma.com Pagerank   Alexa rank for 247bestpillpharma.com 1   website value of 247bestpillpharma.com $ 8,833,062,960.00

Google Calendar - Sign in to Access & Edit Your Schedule

247bestpillpharma.com favicon - calendar.google.com

Access Google Calendar with a Google account (for personal use) or Google Workspace account (for business use).

View 247bestpillpharma.com Pagerank   Alexa rank for 247bestpillpharma.com 1   website value of 247bestpillpharma.com $ 8,833,062,960.00

Gmail

247bestpillpharma.com favicon - mail.google.com

Gmail is email that’s intuitive, efficient, and useful. 15 GB of storage, less spam, and mobile access.

View 247bestpillpharma.com Pagerank   Alexa rank for 247bestpillpharma.com 1   website value of 247bestpillpharma.com $ 8,833,062,960.00

Android Apps on Google Play

247bestpillpharma.com favicon - play.google.com

Enjoy millions of the latest Android apps, games, music, movies, TV, books, magazines & more. Anytime, anywhere, across your devices.

View 247bestpillpharma.com Pagerank   Alexa rank for 247bestpillpharma.com 1   website value of 247bestpillpharma.com $ 8,833,062,960.00

Google Chrome - Download the Fast, Secure Browser from Google

247bestpillpharma.com favicon - chrome.google.com

Get more done with the new Google Chrome. A more simple, secure, and faster web browser than ever, with Google’s smarts built-in. Download now.

View 247bestpillpharma.com Pagerank   Alexa rank for 247bestpillpharma.com 1   website value of 247bestpillpharma.com $ 8,833,062,960.00

Full WHOIS Lookup for 247bestpillpharma.com

Domain Name: 247BESTPILLPHARMA.COM
Registry Domain ID: 2750649697_DOMAIN_COM-VRSN
Registrar WHOIS Server: whois.ownregistrar.com
Registrar URL: http://www.ownregistrar.com
Updated Date: 2023-01-11T17:18:07Z
Creation Date: 2023-01-11T17:17:50Z
Registry Expiry Date: 2024-01-11T17:17:50Z
Registrar: OwnRegistrar, Inc.
Registrar IANA ID: 1250
Registrar Abuse Contact Email:
Registrar Abuse Contact Phone:
Domain Status: clientTransferProhibited https://icann.org/epp#clientTransferProhibited
Name Server: NS1.BH-HT-17.WEBHOSTBOX.NET
Name Server: NS2.BH-HT-17.WEBHOSTBOX.NET
DNSSEC: unsigned
URL of the ICANN Whois Inaccuracy Complaint Form: https://www.icann.org/wicf/
>>> Last update of whois database: 2023-01-21T12:17:42Z